PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI10G08100.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 559aa    MW: 61907.8 Da    PI: 6.079
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI10G08100.4genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS433.71.4e-1321895581373
             GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                      l++++++c +av+++d +l++ l+++l +++s +gdp+qRl ay++e+L arl++s+s++yk+l+++e +   sse +++++l++e++P++kf+
  ORUFI10G08100.4 189 LKQVIIACGKAVAENDVRLTELLISELGQMVSVSGDPLQRLGAYMLEGLVARLSSSGSKIYKSLKCKEPT---SSELMSYMHLLYEICPFFKFG 279
                      57899****************************************************************9...9******************** PP

             GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrl 186
                      ++ aN aI ea++ge+ vHiiDf+i qG QW++L+qaLa+Rp+gpp lRiTg+++++s   +   l  +g rL k+A+++g+pfefn+ v  + 
  ORUFI10G08100.4 280 YMSANGAIAEAIKGENFVHIIDFQIAQGSQWMTLIQALAARPGGPPFLRITGIDDSNSAyaRGGGLDIVGMRLYKVAQSFGLPFEFNA-VPAAS 372
                      *******************************************************988899999************************.79999 PP

             GRAS 187 edleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklprese 280
                      +++ le+L+++ gE+++Vn+++qlh+++desvs+e++rd++L++vkslsP++v++veqe+++n+ +F+ r le+l+yy+a+f+s+++ lpr+++
  ORUFI10G08100.4 373 HEVYLEHLDIRVGEVIVVNFAYQLHHTPDESVSTENHRDRILRMVKSLSPRLVTLVEQESNTNTRPFFPRYLETLDYYTAMFESIDVALPRDDK 466
                      ********************************************************************************************** PP

             GRAS 281 erikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                       r++ E+++++r+ivn++acegaer+erhe ++kW++rl++aGF+p+pls+ +++++k+ll++++s  yr+ee++g l+lgWk+r Lv+ SaW
  ORUFI10G08100.4 467 RRMSAEQHCVARDIVNLIACEGAERVERHEVFGKWKARLTMAGFRPYPLSSVVNSTIKTLLHTYNSF-YRLEERDGVLYLGWKNRVLVVSSAW 558
                      *****************************************************************65.************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.493163540IPR005202Transcription factor GRAS
PfamPF035144.9E-130189558IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009640Biological Processphotomorphogenesis
GO:0005737Cellular Componentcytoplasm
GO:0004871Molecular Functionsignal transducer activity
Sequence ? help Back to Top
Protein Sequence    Length: 559 aa     Download sequence    Send to blast
MDGRINSLLS TIPQDFTSMS ARASNHAYIC SDDSQMPYYN NSVPSGGNGR FYITQNHQDA  60
HYASSDDGSQ KIGSSPQAFE APYCTLESSS ANGAHPAHSS ASSHSISPIS GSPLSHHDSH  120
SDHTYNSPPS ASCVTEITDL QIKLRELENA ILGPELDIAY DSPESALQPN IMATPENWRQ  180
LLGINTGDLK QVIIACGKAV AENDVRLTEL LISELGQMVS VSGDPLQRLG AYMLEGLVAR  240
LSSSGSKIYK SLKCKEPTSS ELMSYMHLLY EICPFFKFGY MSANGAIAEA IKGENFVHII  300
DFQIAQGSQW MTLIQALAAR PGGPPFLRIT GIDDSNSAYA RGGGLDIVGM RLYKVAQSFG  360
LPFEFNAVPA ASHEVYLEHL DIRVGEVIVV NFAYQLHHTP DESVSTENHR DRILRMVKSL  420
SPRLVTLVEQ ESNTNTRPFF PRYLETLDYY TAMFESIDVA LPRDDKRRMS AEQHCVARDI  480
VNLIACEGAE RVERHEVFGK WKARLTMAGF RPYPLSSVVN STIKTLLHTY NSFYRLEERD  540
GVLYLGWKNR VLVVSSAWC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-571915586374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1133350.0AC113335.1 Genomic sequence for Oryza sativa (japonica cultivar-group) cultivar Nipponbare clone OJ1003C07, from chromosome 10, complete sequence.
GenBankAP0149660.0AP014966.1 Oryza sativa Japonica Group DNA, chromosome 10, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015614551.10.0PREDICTED: scarecrow-like protein 21
RefseqXP_015614552.10.0PREDICTED: scarecrow-like protein 21
SwissprotQ8GVE10.0CIGR2_ORYSJ; Chitin-inducible gibberellin-responsive protein 2
TrEMBLA0A0D3HCW90.0A0A0D3HCW9_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0B9L30.0A0A0E0B9L3_9ORYZ; Uncharacterized protein
TrEMBLA0A0E0QY930.0A0A0E0QY93_ORYRU; Uncharacterized protein
STRINGLOC_Os10g22430.10.0(Oryza sativa Japonica Group)
STRINGORGLA10G0063900.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP151337117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein